PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G33710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 453aa    MW: 47925.8 Da    PI: 5.0267
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G33710.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.95.7e-18370403134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C++C+  kTp+WR gp g+ktLCnaCG++y++ +
  OPUNC02G33710.1 370 CTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGR 403
                      *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.57E-14363426No hitNo description
SMARTSM004011.6E-15364414IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.082364400IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.8E-14368401IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.33E-14369426No hitNo description
PROSITE patternPS003440370395IPR000679Zinc finger, GATA-type
PfamPF003201.3E-15370403IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MSMLETSKAD RGERSRPVLI DRCEETETNF NTDCDLVAAM AGVGFVEDML REQSLLEATC  60
GDLFDHIDDL LDFPKEESAA DVLLLDAPAP GSPLSSRIIG GHVAMAAAAP PPPPQMMALP  120
PPPAPAKDDA SALFDAAGAL GAEVFDRKDA HIGSCDELDM DMEWLSELFD DGTIPHEPSF  180
PGANCAAPIK ASALTANAGV VLPDKMEEAL FRSSSPISVL EHSGFNVATN GGSSSSSSSS  240
ASSSSESFSG SGRAWSAPVS PRPEPPVLVI PARARSKRSR PSAFPAVRGA PAATETTILV  300
PTPMYSSTSS HSDPESIAES NPHPPPMKKK KKAKKPAAPA ASDAEADADA DADYEEGGAL  360
ALPPGTVRRC THCQIEKTPQ WRAGPLGPKT LCNACGVRYK SGRLFPEYRP AASPTFVPSI  420
HSNSHKKVVE MRQKATRTAD QSCDLLQYIR RRD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8289650.0CT828965.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA219J10, full insert sequence.
GenBankCT8289660.0CT828966.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA222D18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626108.10.0PREDICTED: GATA transcription factor 11
RefseqXP_015626107.10.0PREDICTED: GATA transcription factor 11
TrEMBLA0A0E0K6J60.0A0A0E0K6J6_ORYPU; Uncharacterized protein
STRINGORGLA02G0317800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51693451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.21e-36GATA family protein